Tongren Polytechnic College

Guizhou, China

Tongren Polytechnic College

Guizhou, China
SEARCH FILTERS
Time filter
Source Type

PubMed | Tongren Polytechnic College and China Agricultural University
Type: Journal Article | Journal: Biomedical and environmental sciences : BES | Year: 2016

Chlamydia psittaci is an avian respiratory pathogen and zoonotic agent. The wide prevalence of C. psittaci poses a threat to the poultry industry and its employees. However, few commercial kits are available for detecting avian antibodies excluding the in-house ELISA kit. In this study, we developed a novel ELISA kit for detecting antibodies against C. psittaci based on the N-terminal fragment of polymorphic outer membrane protein D (PmpD-N) as the coating antigen.The antigen concentrations, primary antibody, and cut-off value were determined and optimized. The ELISA, designated PmpD-N ELISA, was assessed for sensitivity, specificity, and concordance using sera samples from 48 experimentally infected and 168 uninfected SPF chickens.The sensitivity and specificity of PmpD-N ELISA were 97.9%, 100%, respectively, while the concordance was 98.1% as compared to that of MOMP-ELISA. No cross-reaction with positive sera for other avian pathogens was found. Using PmpD-N ELISA, 799/836 clinical samples were positive, including 93.0% and 98.1% positivity in layers and broilers, respectively.These data indicate that indirect ELISA with PmpD-N as the antigen candidate is a promising approach for the surveillance of C. psittaci infection.


Huang G.R.,Jiangnan University | Huang G.R.,Tongren Polytechnic College | Wang L.H.,Jiangnan University | Zhou Q.,Jiangnan University
Environmental Science and Pollution Research | Year: 2014

Rare earth element accumulation in the soil and elevated ultraviolet (UV)-B radiation (280-315 nm) are important environmental issues worldwide. To date, there have been no reports concerning the combined effects of lanthanum (La)(III) and elevated UV-B radiation on plant roots in regions where the two issues occur simultaneously. Here, the combined effects of La(III) and elevated UV-B radiation on the growth, biomass, ion absorption, activities, and membrane permeability of roots in soybean (Glycine max L.) seedlings were investigated. A 0.08 mmol L-1 La(III) treatment improved the root growth and biomass of soybean seedlings, while ion absorption, activities, and membrane permeability were obviously unchanged; a combined treatment with 0.08 mmol L-1 La(III) and elevated UV-B radiation (2.63/6.17 kJ m-2 day-1) exerted deleterious effects on the investigated indices. The deleterious effects were aggravated in the other combined treatments and were stronger than those of treatments with La(III) or elevated UV-B radiation alone. The combined treatment with 0.24/1.20 mmol L-1 La(III) and elevated UV-B radiation exerted synergistically deleterious effects on the growth, biomass, ion absorption, activities, and membrane permeability of roots in soybean seedlings. In addition, the deleterious effects of the combined treatment on the root growth were due to the inhibition of ion absorption induced by the changes in the root activity and membrane permeability. © 2013 Springer-Verlag Berlin Heidelberg.


Huang G.,Jiangnan University | Huang G.,Tongren Polytechnic College | Wang L.,Jiangnan University | Zhou Q.,Jiangnan University
Biological Trace Element Research | Year: 2013

Ultraviolet-B (UV-B, 280-320 nm) radiation has seriously affected the growth of plants. Finding the technology/method to alleviate the damage of UV-B radiation has become a frontal topic in the field of environmental science. The pretreatment with rare earth elements (REEs) is an effective method, but the regulation mechanism of REEs is unknown. Here, the regulation effects of lanthanum (La(III)) on nitrogen assimilation in soybean seedlings (Glycine max L.) under ultraviolet-B radiation were investigated to elucidate the regulation mechanism of REEs on plants under UV-B radiation. UV-B radiation led to the inhibition in the activities of the key enzymes (nitrate reductase, glutamine synthetase, glutamate synthase) in the nitrogen assimilation, the decrease in the contents of nitrate and soluble proteins, as well as the increase in the content of amino acid in soybean seedlings. The change degree of UV-B radiation at the high level (0.45 W m-2) was higher than that of UV-B radiation at the low level (0.15 W m-2). The pretreatment with 20 mg L -1 La(III) could alleviate the effects of UV-B radiation on the activities of nitrate reductase, glutamine synthetase, glutamate synthase, and glutamate dehydrogenase, promoting amino acid conversion and protein synthesis in soybean seedlings. The regulation effect of La(III) under UV-B radiation at the low level was better than that of UV-B radiation at the high level. The results indicated that the pretreatment with 20 mg L-1 La(III) could alleviate the inhibition of UV-B radiation on nitrogen assimilation in soybean seedlings. © 2012 Springer Science+Business Media New York.


Huang G.,Jiangnan University | Huang G.,Tongren Polytechnic College | Wang L.,Jiangnan University | Sun Z.,Jiangnan University | And 3 more authors.
Biological Trace Element Research | Year: 2015

Rare earth element pollution and elevated ultraviolet-B (UV-B) radiation occur simultaneously in some regions, but the combined effects of these two factors on plants have not attracted enough attention. Nitrogen nutrient is vital to plant growth. In this study, the combined effects of lanthanum(III) and elevated UV-B radiation on nitrate reduction and ammonia assimilation in soybean (Glycine max L.) roots were investigated. Treatment with 0.08 mmol L−1 La(III) did not change the effects of elevated UV-B radiation on nitrate reductase (NR), nitrite reductase (NiR), glutamine synthetase (GS), glutamate synthase (GOGAT), glutamate dehydrogenase (GDH), nitrate, ammonium, amino acids, or soluble protein in the roots. Treatment with 0.24 mmol L−1 La(III) and elevated UV-B radiation synergistically decreased the NR, NiR, GS, and GOGAT activities as well as the nitrate, amino acid, and soluble protein levels, except for the GDH activity and ammonium content. Combined treatment with 1.20 mmol L−1 La(III) and elevated UV-B radiation produced severely deleterious effects on all test indices, and these effects were stronger than those induced by La(III) or elevated UV-B radiation treatment alone. Following the withdrawal of La(III) and elevated UV-B radiation, all test indices for the combined treatments with 0.08/0.24 mmol L−1 La(III) and elevated UV-B radiation recovered to a certain extent, but they could not recover for treatments with 1.20 mmol L−1 La(III) and elevated UV-B radiation. In summary, combined treatment with La(III) and elevated UV-B radiation seriously affected nitrogen nutrition in soybean roots through the inhibition of nitrate reduction and ammonia assimilation. © 2014, Springer Science+Business Media New York.


Hu M.,Nanjing Agricultural University | Hu M.,Tongren Polytechnic College | Zhao H.,Nanjing Agricultural University | Zhang C.,Nanjing Agricultural University | And 2 more authors.
Journal of Agricultural and Food Chemistry | Year: 2013

Presumptive lactic acid bacteria (LAB) strains isolated from traditional Chinese fermented vegetables were screened for bacteriocin production. A novel bacteriocin-producing strain, Lactobacillus plantarum 163, was identified on the basis of its physiobiochemical characteristics and characterized by 16S rDNA sequencing. The novel bacteriocin, plantaricin 163, produced by Lb. plantarum 163 was purified by salt precipitation, gel filtration, and reverse-phase high-performance liquid chromatography (RP-HPLC). Matrix-assisted laser desorption/ionization time-of-flight mass spectrometry (MALDI-TOF-MS) analysis of plantaricin 163 revealed the molecular weight to be 3553.2 Da. The complete amino acid sequence showed VFHAYSARGNYYGNCPANWPSCRNNYKSAGGK, and no similarity to known bacteriocins was found. Plantaricin 163 was highly thermostable (20 min, 121 C), active in the presence of acidic pH (3 - 5), sensitive to protease, and exhibited broad-spectrum antimicrobial activity against LAB and other tested Gram-positive and Gram-negative bacteria. The results suggest that plantaricin 163 may be employed as a biopreservative in the food industry. © 2013 American Chemical Society.


Liang Y.-Y.,Tongren Polytechnic College | Yin S.-S.,Tianjin University | Zuo B.-M.,Tianjin University of Science and Technology | Gao W.-Y.,Tianjin University | Gao W.-Y.,Tianjin University of Science and Technology
Zhongguo Zhongyao Zazhi | Year: 2012

Objective: To systematically optimize the cultivation conditions of adventitious roots of Pseudoxtellariae heterophylla.Method: Tissue cultivation technology and ultraviolet spectrophotometry were adopted to observe the effect of inoculum volume, sucrose concentration, inorganic salt concentration, number of cultivation days, gradual scale-up cultivation and bubble different angles of bioreactor on the growth of adventitious roots of P. heterophylla, and determine the content of constituents such as saponin, polysaccharide and amino acid.Result: The propagation multiple of adventitious roots reached the maximum when the inoculum was 6 g in a 1 L culture shake flask. With the increase in sucrose concentration, the dry weight propagation multiples of adventitious roots followed an up and down trend. The inorganic salt concentration in a cultivation dish had a greater effect on the growth of adventitious roots, particularly 3/4 MS was the most favorable for the growth of adventitious roots. The growth curve of P. heterophylla was "S", with the biomass reaching the maximum at the 28th day.Conclusion: The inoculum volume, sucrose concentration, inorganic salt concentration, gradual scale-up cultivation and angles of bubble bioreactor had a significant effect on the growth of adventitious roots of P. heterophylla. The contents of saponin and amino acid in adventitious roots were higher than that in cultivated P. heterophylla, whereas the polysaccharide content were lower than that in cultivated P. heterophylla.


Zhang J.J.,Nanjing Agricultural University | Zhang J.J.,Tongren Polytechnic College | Zhou Z.S.,Nanjing Agricultural University | Song J.B.,Nanjing Agricultural University | And 2 more authors.
Journal of Hazardous Materials | Year: 2012

The residue of atrazine (a herbicide) has become hazards in environments due to its intensive use. However, its molecular toxicity to on plants and human beings is not fully understood. In this study, we performed high-throughput sequencing of atrazine-exposed rice (. Oryza sativa) to analyze global expression and complexity of genes in the crop. Four libraries were constructed from shoots and roots with or without atrazine exposure. We sequenced 5,751,861, 5,790,013, 5,375,999 and 6,039,618 clean tags that corresponded to 220,806, 111,301, 248,802 and 114,338 distinct tags for Root-Atr (root control, atrazine-free), Shoot-Atr (shoot control, atrazine-free), Root. +. Atr (root treated with atrazine) and Shoot. +. Atr (shoot treated with atrazine) libraries, respectively. Mapping the clean tags to gene databases generated 18,833-21,007 annotated genes for each library. Most of annotated genes were differentially expressed among the libraries. The most 40 differentially expressed genes were associated with resistance to environmental stress, degradation of xenobiotics and molecular metabolism. Validation of gene expression by quantitative RT-PCR confirmed the deep-sequencing results. The transcriptome sequences were further subjected to Gene Orthology (GO) and Kyoto Encyclopedia of Genes and Genomes (KEGG) analysis and showed modified biological functions and metabolic pathways. Our results not only highlight the transcriptional complexity in rice with atrazine but also represent a major improvement for analyzing transcriptional changes on a large scale in xenobiotics-responsive toxicology. © 2012 Elsevier B.V.


Ning N.,Southwest University | Ning N.,Tongren Polytechnic College | Wang Y.Z.,Southwest University | Zou Z.Y.,Southwest University | And 3 more authors.
Environmental Toxicology and Pharmacology | Year: 2015

The aim of this study was to investigated the pharmacological activities and safety of fibrous root of Rhizoma Coptidis (FRC). FRC not only protected Kunming mice from the minimal lethal dose of Escherichia coli, but also protected rabbits from hyperpyrexia induced by lipopolysaccharid (LPS). The acute toxicity study showed that oral medial lethal dose (LD50) of FRC was greater than 7000mg/kg body weight in Kunming mice. The sub-chronic toxicity study showed that the no-observed-adverse effect level (NOAEL) of FRC was 1.88g/kg body weight in Sprague-Dawley rats, whereas FRC at higher dose (3.76g/kg body weight) resulted in damage to liver and lung. Negative results were present in Ames test, mouse micronucleus test and mouse sperm abnormality test. These finding support the use of FRC in veterinary medicine. © 2014 Elsevier B.V.


Yu H.M.,Tongren Polytechnic College
Advanced Materials Research | Year: 2014

Some multimedia teaching software based on the content analysis of already existing problem in the design process to understand the current situation of multimedia teaching software design university. A deep understanding of the knowledge classification learning theory is proposed on the basis of the knowledge classification learning theory as the guiding theory of software design can change the status. And put forward the knowledge classification learning specific design methodology under the guidance of the declarative and procedural knowledge of autonomous learning and multimedia teaching software. Finally based on the above specific strategies to achieve the design these kinds of knowledge learning multimedia teaching software. © (2014) Trans Tech Publications, Switzerland.


Zhao C.,Tongren Polytechnic College | Yu J.,Tongren Polytechnic College | Peng R.,Tongren Polytechnic College | Rao M.,Tongren Polytechnic College | Hu M.,Tongren Polytechnic College
Designed Monomers and Polymers | Year: 2015

In this study, biodegradable dendritic copolymers consisting of poly(L-lactide) (PLLA) block as the core and Arg-Gly-Asp (RGDfK) peptides as the dendritic branches (PLLA-d-RGD) with assistance of solid-phase chemistry were synthesized. The chemical architectures were confirmed with 1H NMR test, matrix-assisted laser desorption/ionization time-of-flight mass spectra, and gel permeation chromatography test. PLLA-d-RGD, along with dendritic PLLA with PLLA block as the core and L-lysine as the dendritic branches (PLLA-d) and PLLA as controls, was further investigated in terms of water contact angle, protein adsorption, and in vitro MC3T3-E1 cell behavior. Water contact angle measurements demonstrated that hydrophilicity was improved from 67.5 ± 1.7° on PLLA films to 59.3 ± 2.3° and 47.2 ± 2.5° on PLLA-d and PLLA-d-RGD films, respectively. The fibronectin adsorption was also enhanced on PLLA-d and PLLA-d-RGD films. The MC3T3-E1 cell functions including cell adhesion, attachment, proliferation, and differentiation were prominently promoted on PLLA-d and especially PLLA-d-RGD films. © 2015 Taylor & Francis.

Loading Tongren Polytechnic College collaborators
Loading Tongren Polytechnic College collaborators