Kunming, China
Kunming, China

Time filter

Source Type

Xia H.,CAS Wuhan Institute of Virology | Li P.,Kunming Yanan Hospital | Yang J.,CAS Wuhan Institute of Virology | Pan L.,CAS Wuhan Institute of Virology | And 12 more authors.
International Journal of Infectious Diseases | Year: 2011

Objectives: We aimed to determine the seroprevalence of Crimean-Congo hemorrhagic fever virus (CCHFV) infection in Yunnan Province, China. Materials and methods: One thousand six hundred and fifty-seven human serum samples and 1280 ticks (Hyalomma asiaticum) were collected from five counties (Menglian, Menghai, Lancang, Mengla, and Ximeng). Serum samples were analyzed independently by indirect immunofluorescence assay and Western blotting to detected CCHFV antibody. The ticks were examined by reverse transcriptase-polymerase chain reaction (RT-PCR) to detect virus RNA. Results: The CCHFV IgG positivity was 3.4% (57/1657). A multivariate analysis was performed, and variables that increased the chance of infection were found to include history of tick bite or contact (odds ratio (OR) 16.6, 95% confidence interval (CI) 7.5-37.0) and age > 30 years (OR 6.8, 95% CI 1.6-28.2). The RT-PCR positive rate for ticks was 14.3% (6/42). Conclusions: The five counties (Menglian, Menghai, Lancang, Mengla, and Ximeng) in Yunnan are areas with the potential for CCHF outbreaks. Residents should protect themselves against tick bites and the surveillance of CCHFV in this region should be improved. © 2011 International Society for Infectious Diseases.


Zhu N.,CAS Wuhan Institute of Virology | Zhu N.,Gnomegen Inc. | Li P.,Kunming yanAn Hospital | Yu J.,CAS Wuhan Institute of Virology | And 9 more authors.
Virus Genes | Year: 2013

The current circulating influenza B viruses can be divided into two major phylogenetic lineages: the Victoria and Yamagata lineages. We conducted a survey of influenza B viruses in Hubei and Zhejiang provinces during 2009-2010. Out of 341 throat swabs, 18 influenza B viruses were isolated. Five isolates were selected for genetic and phylogenetic analysis. The molecular analyses revealed that all the isolates had similar antigenic characteristics to B/Brisbane/60/2008. However, in the three viruses isolated from Zhejiang, a single asparagine to aspartic acid substitution in position 197 was observed, thereby eliminating the glycosylation at that site and possibly causing an antigenic change. None of the viruses had amino acid mutations at positions 116, 149, 152, 198, 222, 250, 291, and 402 of the neuraminidase (NA) gene, predicting that the viruses would still be sensitive to NA inhibitors. Phylogenetic analyses revealed that all five isolates were closely related to B/Brisbane/60/2008 - the 2010 vaccine strain - and contained Victoria-like hemagglutinin and Yamagata-like NA genes, suggesting that reassortment may had occurred. In addition, similar phylogenetic patterns among the acidic polymerase, nucleoprotein and matrix protein genes, as well as between the basic polymerase 1 and basic polymerase 2 genes, were observed, suggesting possible functional interactions among these proteins. All the results highlighted the importance of molecular monitoring of influenza B viruses for reassortment and antigenic drift. © 2012 Springer Science+Business Media New York.


Wang W.-P.,Peking Union Medical College | He Z.-L.,Peking Union Medical College | Lu S.-Y.,Peking Union Medical College | Yan M.,Kunming Medical University | And 7 more authors.
Current Stem Cell Research and Therapy | Year: 2015

Bone marrow-derived mesenchymal stem cells hold great potential for cytotherapeutics of neurodegenerative disorders, including Parkinson’s disease. The neurotrophic factor neurturin can rescue dopaminergic neurons damaged during the disease process. Lmx1α can promote mesencephalic dopaminergic differentiation during embryogenesis. In this study, we tested a cytotherapeutic strategy combining NTN/Lmx1α gene therapy and cell transplantation to ameliorate disease progression in hemiparkinsonian rhesus. Rhesus BMSCs were prepared for autologous grafting by transfection with recombinant adenoviral vectors expressing secreted NTN and Lmx1α, and cultured in the presence of induce factors, particularly the Lmx1α regulatory factor sonic hedgehog, to guide dopaminergic differentiation. These induced rh-BMSCs exhibited gene/protein expression phenotypes resembling nigral dopaminergic neurons. They survived and retained dopaminergic function following stereotaxic injection into the MPTPlesioned right-side substantia nigra as indicated by SPECT measurement of DAT activity. Injected cells preserved and supplemented the remaining endogenous population of dopamine neurons (TH-positive cell ipsilateral/contralateral ratio was 56.81% ± 7.28% vs. 3.86%±1.22% in vehicle-injected controls; p<0.05). Cell injection also partially restored motor function and reduce apomorphine-evoked rotation (p<0.05). Moreover, function recovery occurred earlier than in previous studies on injected BMSCs. Our findings demonstrate a promising strategy for restoration of PD-associated motor dysfunction by transplantation of autologous BMSCs overexpressing NTN/Lmx1α. © 2015 Bentham Science Publishers.


He Y.,Kunming Yanan Hospital | Yang Y.,Kunming Yanan Hospital
International Eye Science | Year: 2013

AIM: To evaluate the clinical effects of vitrectomy in treating infectious endophthalmitis after cataract surgery. METHODS: Totally 17 cases(17 eyes) suffered from infectious endophthalmitis after cataract surgery were analyzed retrospectively, endophthalmitis were treated with vitrectomy, postoperative follow-up of 3 months to 24 months. RESULTS: After vitrectomy, intraocular infection of 17 cases was controlled, the vision improved at different degree, and all the eyeballs were saved. CONCLUSION: Timely vitrectomy is a kind of effective and safe method for the endophthalmitis after cataract surgery.


LIU W.-H.,Nanjing Agricultural University | CHEN Y.,Nanjing Agricultural University | BAI X.-W.,Nanjing Agricultural University | YAO H.-M.,Nanjing Agricultural University | And 3 more authors.
Chinese Journal of Natural Medicines | Year: 2016

The present study was designed to identify immunomodulatory components from the leech salivary gland of Haemadipsa sylvestris. The Sephadex G-50, ResourceTM S column chromatography and reverse-phase high performance liquid chromatography (RP-HPLC) were used to isolate and purify the salivary gland extracts (SGE). Structural analysis of isolated compounds was based on Edman degradation and matrix assisted laser desorption ionization time-of-flight mass spectrometer (MALDI-TOF-MS). The cDNA encoding the precursor of the compound was cloned from the cDNA library of the salivary gland of H. sylvestris. The levels of inflammatory mediators, including tumor necrosis factor-α (TNF-α), interferon γ (IFN-γ), interleukin-6 (IL-6), and monocyte chemotactic protein-1 (MCP-1) were assayed using an enzyme-linked immunosorbent assay (ELISA). The effects on cell proliferation and cell viability were observed using MTT assay. A novel neuropeptide Y (Neuropeptide Y-HS) from the leech salivary gland of H. sylvestris was purified and characterized. It was composed of 36 amino acid residues and the amino acid sequence was determined to be FLEPPERPAVFTSVEQMKSYIKALNDYYLLLGRPRF-NH2, containing an amidated C-terminus. It showed significant inhibitory effects on the production of inflammatory cytokines including TNF-α, IFN-γ, IL-6, and MCP-1. Neuropeptide Y was identified from leeches for the first time. The presence of neuropeptide Y-HS in leech salivary gland may help get blood meal from hosts and inhibit inflammation. © 2016 China Pharmaceutical University


Zhang Z.,CAS Kunming Institute of Zoology | Zhang Z.,University of Chinese Academy of Sciences | Meng P.,Nanjing Agricultural University | Han Y.,Nanjing Agricultural University | And 11 more authors.
Immunity | Year: 2015

Atherosclerosis is a chronic inflammatory disease of arterial wall. Mitochondrial DNA (mtDNA) and human antimicrobial peptide LL-37 (Cramp in mice) are involved in atherosclerosis. Recently, mtDNA has been found to escape from autophagy and cause inflammation. Normally, mtDNA as an inflammatogenic factor cannot escape from autophagy and degradation by DNase II. In this study, we found elevated amounts of LL37-mtDNA complex in atherosclerotic plasma and plaques. The complex was resistant to DNase II degradation and escaped from autophagic recognition, leading to activation of Toll-like receptor 9 (TLR9)-mediated inflammatory responses. Mouse model studies indicated that Cramp-mtDNA complex aggravated atherosclerotic lesion formation in apolipoprotein E-deficient mice and antibody treatment against the complex alleviated the lesion. These findings suggest that the LL-37-mtDNA complex acts as a key mediator of atherosclerosis formation, and thus represents a promising therapeutic target. © 2015 Elsevier Inc.


Wang W.,Kunming Yanan Hospital | Wang W.,Kunming Medical University | Hou Z.,Kunming Yanan Hospital | Hou Z.,Kunming Medical University | And 8 more authors.
Meta Gene | Year: 2013

Background: Inconsistent results were reported in recent literature regarding the association between methylenetetrahydrofolate reductase (MTHFR) C677T/A1298C polymorphisms and the susceptibility of congenital heart disease (CHD). In this study, we performed a meta-analysis to investigate the associations by employing multiple analytical methods. Methods: Literature search was performed and published articles were obtained from PubMed, Embase and CNKI databases based on the exclusion and inclusion criteria. Data were extracted from eligible studies and the crude odds ratios and their corresponding 95% confidence intervals (CIs) were calculated using random or fix effects model to evaluate the associations between the MTHFR C677T/A1298C polymorphisms and CHD development. Subgroup based analysis was performed by Hardy-Weinberg equilibrium, ethnicity, types of CHD, source of control and sample size. Results: Twenty-four eligible studies were included in this meta-analysis. Significant association was found between fetal MTHFR C677T polymorphism and CHD development in all genetic models. The pooled ORs and 95% CIs in all genetic models indicated that MTHFR C677T polymorphism was significantly associated with CHD in Asian, but not Caucasian in subgroup analysis. The maternal MTHFR C677T polymorphism was not associated with CHD except for recessive model. Moreover, neither maternal nor fetal MTHFR A1298C polymorphism was associated with CHD. Conclusion: The fetal MTHFR C677T polymorphism may increase the susceptibility to CHD. Fetal MTHFR C677T polymorphism was more likely to affect Asian fetus than Caucasian. The MTHFR A1298C polymorphism may not be a risk of congenital heart disease. © 2013.


Li R.,Kunming Yanan Hospital
Nan fang yi ke da xue xue bao = Journal of Southern Medical University | Year: 2013

To study the effect of homcysteine on the expression of 3-phosphoinositide-dependent protein kinase 1 (PDK1) in the adipose tissue and explore whether PDK1 inhibits p-Akt(Thr-308) expression and affect PI3K/Akt signal pathway to decrease glucose uptake and utilization. Forty mice were randomly divided into 4 groups (n=10), namely the fasting control group, feeding control group, fasting hyperhomocysteinemia group, and feeding hyperhomocysteinemia group. In the two hyperhomocysteinemia groups, the mice were given water containing 1.5% methionine to induce hyperhomocysteinemia. Blood glucose and insulin levels in each group were determined, and the expressions of PDK1 and Akt mRNA in the adipose tissue were detected using RT-PCR; the expressions of PDK1, p-Akt(Thr-308) and Akt proteins were detected using Western blotting. In the fasting and feeding hyperhomocysteinemia groups, blood glucose and insulin levels were significantly higher than those in the two control groups. The expressions of PDK1 mRNA and PDK1 and p-Akt(Thr-308) proteins were reduced in the two hyperhomocysteinemia groups, but Akt mRNA and protein expressions were comparable with those in the control groups. Homocysteine lowers the uptake and utilization of glucose by down-regulating PDK1 expression and affecting PI3K/Akt signal pathway to cause disturbance of glucose metabolism.


Huang Y.,Kunming Yanan Hospital | Zhu W.,Kunming Yanan Hospital | Yao Y.,Kunming Yanan Hospital | Wang J.,Kunming Yanan Hospital | Weng Y.,Kunming Yanan Hospital
Chinese Journal of Infection and Chemotherapy | Year: 2015

Objective To investigate the changing pattern of antibiotic resistance in the extended-spectrum ß-lactamases(ESBLs) producing Escherichia coli strains for better supporting clinical treatment and infection control. Methods WHONET 5. 6 software was used to analyze the changing pattern of antibiotic resistance in ESBLs-producing E. coli during the period from 2001 to 2012. Results During the period from 2001 to 2012, a total of 3177 non-duplicate E. coli strains were isolated in our hospital, of which 1906 were ESBLs-producing E. coli. The overall prevalence of ESBLs was 60.0% (1906/3177). In 2001, the prevalence of ESBLs was the lowest (36.9%), and since then increased gradually. An obvious increase was documented from 2003 (48. 4%) to 2004 (63.2%). In 2008, the prevalence of ESBLs reached peak of 72.9%. During 2004 and 2012, the prevalence of ESBLs ranged from 54. 2% to 72. 9%. And from 2008 to 2012, the rate declined yearly. Among the common antibiotics, meropenem (95.5%) and imipenem (95. 1%) showed the highest susceptibility rate. About 91.9%, 85.7%, 74.1%, 85.7%, 72.6%, 76. 3%,61. 4% of these strains were still sensitive to amikacin, piperacillin-tazobactam, cefoperazone-sulbactam, nitrofurantoin, cefoxitin, cefepime, and ceftazidime, respectively. About 27.8% and 30.3% of these strains were susceptible to ciprofloxacin and levofloxacin, respectively. Conclusions After a period of rapid increase, the prevalence of ESBLs-producing E. coli seems stable now. Carbapenems such as meropenem and imipenem are the most active antibiotics against ESBLs-producing E. coli. Piperacillin-tazobactam, cefoperazone-sulbactam, amikacin, nitrofurantoin, cefoxitin, cefepime, and ceftazidime also provide relatively high antimicrobial activity. Fluoroquinolones are no longer suitable for treatment of the infections caused by ESBLs-producing E. coli. © 2015, Editorial Department of Chinese Journal of Infection. All rights reserved.


PubMed | Kunming Yanan Hospital and Nanjing Agricultural University
Type: Journal Article | Journal: Chinese journal of natural medicines | Year: 2016

The present study was designed to identify immunomodulatory components from the leech salivary gland of Haemadipsa sylvestris. The Sephadex G-50, Resource(TM) S column chromatography and reverse-phase high performance liquid chromatography (RP-HPLC) were used to isolate and purify the salivary gland extracts (SGE). Structural analysis of isolated compounds was based on Edman degradation and matrix assisted laser desorption ionization time-of-flight mass spectrometer (MALDI-TOF-MS). The cDNA encoding the precursor of the compound was cloned from the cDNA library of the salivary gland of H. sylvestris. The levels of inflammatory mediators, including tumor necrosis factor- (TNF-), interferon (IFN-), interleukin-6 (IL-6), and monocyte chemotactic protein-1 (MCP-1) were assayed using an enzyme-linked immunosorbent assay (ELISA). The effects on cell proliferation and cell viability were observed using MTT assay. A novel neuropeptide Y (Neuropeptide Y-HS) from the leech salivary gland of H. sylvestris was purified and characterized. It was composed of 36 amino acid residues and the amino acid sequence was determined to be FLEPPERPAVFTSVEQMKSYIKALNDYYLLLGRPRF-NH2, containing an amidated C-terminus. It showed significant inhibitory effects on the production of inflammatory cytokines including TNF-, IFN-, IL-6, and MCP-1. Neuropeptide Y was identified from leeches for the first time. The presence of neuropeptide Y-HS in leech salivary gland may help get blood meal from hosts and inhibit inflammation.

Loading Kunming Yanan Hospital collaborators
Loading Kunming Yanan Hospital collaborators