Zürich, Switzerland
Zürich, Switzerland
SEARCH FILTERS
Time filter
Source Type

Patent
Covagen Inc. | Date: 2012-11-21

The present invention relates to a polypeptide binding to a chymase (EC 3.4.21.39), wherein the polypeptide comprises or consists of an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDY(X^(1))A(X^(2))(X^(3))(X^(4))(X^(5))(X^(6))LSFHKGEKFQIL(X^(1))(X^(8))(X^(9))(X^(10))(X^(11))(X^(12))G(X^(13))(X^(14))WEARS LTTGETGYIPSNYVAPVDSIQ (SEQ ID NO: 1), wherein (X^(1)) is R, N, Q, E, K, H, S, T, C, or D; (X^(2)) is E, T, D, Q, L, P, A, S, C, M, N, E, G, A, V or I; (X^(3)) is R, T, H, N, K, S, C, N or Q; (X^(4)) is S, W, T, C, N, Q, F or Y; (X^(5)) is T, H, L, F, C, S, M, N, Q, R, K, G, A, V, I, P, Y or W; (X^(6)) is D, Q, H, E, S, T, C, N, R or K; (X^(7)) is D, N, R, E, Q, S, T, C, K or D; (X^(8)) is M, W, G, F, A, S, T, C, S, N, Q, Y, V, L, I or P; (X^(9)) is T, H, S, D, C, N, Q, R, K, E or absent; (X^(10)) is V, T, Q, G, A, L, I, P, S, C, M, N or absent; (X^(11)) is P, A, D, G, K, V, L, I, E, R, M, H or absent; (X^(12)) is N, V, P, I, E, T, S, A, G, L, C, M, Q or D; (X^(13)) is D, E, T, P, G, A, V, L, I, S, C, M, N or Q, and (X^(14)) is W, Y, L, G, A, V, I, P, M, or F; (b) an amino acid sequence which is at least 85% identical to the amino acid sequence of (a), wherein the identity determination excludes amino acid positions (X^(1)) to (X^(14)).


Patent
Covagen Inc. | Date: 2016-05-17

The present invention relates to new IL-17 inhibiting polypeptides, corresponding fusion proteins, compositions and medical uses thereof.


Patent
Covagen Inc. | Date: 2014-03-26

The present invention relates to a polypeptide inhibiting the activity of glycosylated IL-17A, wherein the polypeptide comprises or consists of an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDY(X^(1))(X^(2))(X^(3))(X^(4))(X^(5))(X^(6))DLSFHKGEKFQILSTHEYEDWWEARSLTTGETGYIPSNYVAPV DSIQ (SEQ ID NO: 1), wherein amino acid positions (X^(1)) to (X^(6)) may be any amino acid sequence; and (b) an amino acid sequence which is at least 85% identical to the amino acid sequence of (a), wherein the identity determination excludes amino acid positions (X^(1)) to (X6) and provided that the amino acid sequence STHEYE (SEQ ID NO: 2) in amino acid positions 31 to 36 of SEQ ID NO: 1 is conserved. The invention also relates to fusion constructs, compositions and medical uses comprising said polypeptide.


Patent
Covagen Inc. | Date: 2012-04-24

The present invention relates to a polypeptide binding to a chymase (EC 3, 4, 21,39), wherein the polypeptide comprises or consists of an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDY(X^(1))A(X^(2))(X^(3))(X^(4))(X^(5)) (X^(6))LSFHKGEKFQIL(X^(7 )(X^(8))(X^(9))(X^(10)) (X^(11))(X^(12))G(X^(13))(X^(14))WEARSLTTGETGYIPSNYVAPVDSIQ (SEQ ID NO: 1), wherein (X^(1)) is R, N, Q, E, K, H, S, T, C, or D; (X^(2)) is E, T, D, Q, L, P, A, S, C, M, N, E, G, A, V or I; (X^(3)) is R, T, H, N, K, S, C, N or Q; (X^(4)) is S, W, T, C, N, Q, For Y; (X^(5)) is T, H, L, F, C, S, M, N, Q, R, K, G, A, V, I, P, Y or W; (X^(6)) is D, Q, H, E, S, T, C, N, R or K; (X^(7)) is D, N, R, E, Q, S, T, C, K or D; (X^(8)) is M, W, G, F, A, S, T, C, S, N, Q, Y, V, L, I or P; (X^(9)) is T, H, S, D, C, N, Q, R, K, E or absent; (X^(10)) is V, T, Q, G, A, L, I, P, S, C, M, N or absent; (X^(11)) is P, A, D, G, K, V, L, I, E, R, M, H or absent; (X^(12)) is N, V, P, I, E, T, S, A, G, L, C, M, Q or D; (X^(13)) is D, E, T, P, G, A, V, L, I, S, C, M, N or Q, and (X^(14)) is W, Y, L, G, A, V, I, P, M, or F; (b) an amino acid sequence which is at least 85% identical to the amino acid sequence of (a), wherein the identity determination excludes amino acid positions (X^(1)) to (X^(14)).


The present invention relates to a polypeptide binding to human serum albumin and comprising or consisting of an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDY(X^(1))(X^(2))(X^(3))(X^(4))(X^(5)) (X^(6))D(X^(7))SFHKGEKFQIL(X^(8))(X^(9))(X^(10))(X^(11))(X^(12))G(X^(13))(X^(14))W(X^(15))(X^(16))RSLTTG(X^(17))(X^(18))G(X^(19))IPSNYVAPVDSIQ (SEQ ID NO: 1), wherein (X^(1)) is A, V, I, L, M, G, P, S, T, N, Q, C, R, H, K, D or E; (X^(2)) is R, H, K, A, V, I, L, M, G, P, S, T, N, Q or C; (X^(3)) is R, H, K, S, T, N, Q, C, F, Y, W, A, V, I, L, M, G or P; (X^(4)) is S, T, N, Q, C, A, V, I, L, M, G, P, R, H, K, F, Y, W, D or E; (X^(5)) is S, T, N, Q, C, D, E, F, Y, W, A, V, I, L, M, G, P, R, H or K; (X^(6)) is F, Y, W, A, V, I, L, M, G, P, R, H, K, S, T, N, Q or C; (X^(7)) is A, V, I, L, M, G, P, R, H or K; (X^(8)) is S, T, N, Q, C, D or E; (X^(9)) is S, T, N, Q, C, D, E, A, V, I, L, M, G, P, F, Y or W; (X^(10)) is A, V, I, L, M, G or P; (X^(11)) is F, Y, W, R, H or K; (X^(12)) is S, T, N, Q, C, F, Y or W; (X^(13)) is F, Y, W, R, H, K, S, T, N, Q, C, D, E, A, V, I, L, M, G or P; (X^(14)) is F, Y, W, A, V, I, L, M, G or P; (X^(15)) is D, E, A, V, I, L, M, G or P; (X^(16)) is A, V, I, L, M, G or P; (X^(17)) is D, E, A, V, I, L, M, G, P, R, H or K; (X^(18)) is S, T, N, Q, C, A, V, I, L, M, G or P; (X^(19)) is F, Y, W, S, T, N, Q or C; and (b) an amino acid sequence which is at least 90% identical to the amino acid sequence of (a), wherein the identity determination excludes amino acid positions (X^(1)) to (X^(19)).


The present invention relates to a fusion protein comprising or consisting of the antibody light chain consisting of SEQ ID NO: 1 and a polypeptide binding to IL-17, wherein said polypeptide binding to IL-17 is located downstream of the C-terminus of said antibody light chain within said fusion protein, and wherein said polypeptide consists of the amino acid sequence of SEQ ID NO: 2, wherein (a) one, two or three amino acids within amino acids positions 10 to 19 of SEQ ID NO: 2 is/are substituted, deleted or added, (b) one, two or three amino acids within amino acids positions 29 to 36 of SEQ ID NO: 2 is/are substituted, deleted or added, and/or (c) the amino acid position 48 is substituted or deleted, provided that the polypeptide binding to IL-17 has at least 85% sequence identity to the amino acid sequence of SEQ ID NO: 2, wherein the determination of identity excludes amino acid positions 12 to 17, 31 to 34 and 48 of SEQ ID NO: 2.


Patent
Covagen Inc. | Date: 2013-09-19

The present invention relates to a polypeptide inhibiting the activity of glycosylated IL-17A, wherein the polypeptide comprises or consists of an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDY(X^(1))(X^(2))(X^(3))(X^(4))(X^(5))(X^(6)) DLSFHKGEKFQIL STHEYEDWWEARSLTTGETGYIPSNYVAPVDSIQ (SEQ ID NO: 1), wherein amino acid positions (X^(1)) to (X^(6)) may be any amino acid sequence; and (b) an amino acid sequence which is at least 85% identical to the amino acid sequence of (a), wherein the identity determination excludes amino acid positions (X^(1)) to (X^(6)) and provided that the amino acid sequence STHEYE (SEQ ID NO: 2) in amino acid positions 31 to 36 of SEQ ID NO: 1 is conserved. The invention also relates to fusion constructs, compositions and medical uses comprising said polypeptide.


The present invention relates to a polypeptide binding to human serum albumin and comprising or consisting of an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDY(X^(1))(X^(2))(X^(3))(X^(4))(X^(5))(X^(6))D(X^(7))SFHKGEKFQIL(X^(8))(X^(9))(X^(10))(X^(11))(X^(12))G(X^(13))(X^(14))W(X^(15))(X^(1 6))RSLTTG(X^(17))(X^(18))G(X^(19))IPSNYVAPVDSIQ (SEQ ID NO: 1), wherein (X^(1)) is A, V, I, L, M, G, P, S, T, N, Q, C, R, H, K, D or E; (X^(2)) is R, H, K, A, V, I, L, M, G, P, S, T, N, Q or C; (X^(3)) is R, H, K, S, T, N, Q, C, F, Y, W, A, V, I, L, M, G or P; (X^(4)) is S, T, N, Q, C, A, V, I, L, M, G, P, R, H, K, F, Y, W, D or E; (X^(5)) is S, T, N, Q, C, D, E, F, Y, W, A, V, I, L, M, G, P, R, H or K; (X^(6)) is F, Y, W, A, V, I, L, M, G, P, R, H, K, S, T, N, Q or C; (X^(7)) is A, V, I, L, M, G, P, R, H or K; (X^(8)) is S, T, N, Q, C, D or E; (X^(9)) is S, T, N, Q, C, D, E, A, V, I, L, M, G, P, F, Y or W; (X^(10)) is A, V, I, L, M, G or P; (X^(11)) is F, Y, W, R, H or K; (X^(12)) is S, T, N, Q, C, F, Y or W; (X^(13)) is F, Y, W, R, H, K, S, T, N, Q, C, D, E, A, V, I, L, M, G or P; (X^(14)) is F, Y, W, A, V, I, L, M, G or P; (X^(15)) is D, E, A, V, I, L, M, G or P; (X^(16)) is A, V, I, L, M, G or P; (X^(17)) is D, E, A, V, I, L, M, G, P, R, H or K; (X^(18)) is S, T, N, Q, C, A, V, I, L, M, G or P; (X^(19)) is F, Y, W, S, T, N, Q or C; and (b) an amino acid sequence which is at least 90% identical to the amino acid sequence of (a), wherein the identity determination excludes amino acid positions (X^(1)) to (X^(19)).


Patent
Covagen Inc. | Date: 2013-09-18

The present invention relates to a HER2-specific binding molecule that specifically binds to two different epitopes of HER2 comprising: (a) a first binding (poly)peptide that specifically binds to a first epitope of HER2; and (b) a second binding (poly)peptide that specifically binds to a second epitope of HER2. The present invention further relates to a nucleic acid molecule encoding the HER2-specific binding molecule of the invention, a vector comprising said nucleic acid molecule as well as a host cell or a non-human host transformed with said vector. The invention also relates to a method of producing a HER2-specific binding molecule of the invention as well as to pharmaceutical and diagnostic compositions. Moreover, the present invention also relates to the HER2-specific binding molecule, the nucleic acid molecule, the vector or the host cell of the invention for use in the treatment of tumors.


Patent
Covagen Inc. | Date: 2013-03-08

The present invention relates to a binding molecule that specifically binds to two different epitopes of an antigen expressed on tumor cells, wherein the binding molecule comprises: (a) a first binding (poly)peptide that specifically binds to a first epitope of said antigen expressed on tumor cells, wherein said first binding (poly)peptide is a Fyn SH3-derived polypeptide; and (b) a second binding (poly)peptide that specifically binds to a second epitope of said antigen expressed on tumor cells. The present invention further relates to a nucleic acid molecule encoding the binding molecule of the invention, a vector comprising said nucleic acid molecule as well as a host cell or a non-human host transformed with said vector. The invention further relates to a method of producing a binding molecule of the invention as well as to pharmaceutical and diagnostic composition. Moreover, the present invention also relates to the binding molecule, the nucleic acid molecule, the vector or the host cell of the invention for use in the treatment of tumors.

Loading Covagen Inc. collaborators
Loading Covagen Inc. collaborators